PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_21132A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 243aa    MW: 26716 Da    PI: 9.7508
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_21132AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.19.9e-143983147
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                               r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Oropetium_20150105_21132A 39 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 83
                               789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.06E-173389IPR009057Homeodomain-like
PROSITE profilePS5129415.4083488IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-73789IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-193786IPR006447Myb domain, plants
SMARTSM007175.3E-113886IPR001005SANT/Myb domain
PfamPF002491.7E-113983IPR001005SANT/Myb domain
CDDcd001678.82E-94184No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MVSAGTPPAQ AQPPQPDAAM AGDDASKKVR KPYTITKSRE SWTEQEHDKF LEALQLFDRD  60
WKKIEAFVGS KTVIQIRSHA QKYFLKVQKN GTSEHVPPPR PKRKAAHPYP QKASKNESNY  120
ALKTDSSSIH RNSGMNATVS SWPHNSIRPV VTSSMVKEDL GAGTLGPNNF CSSSTEGPPR  180
ARQPGETNDQ MNQVPSLRLM PDFTQVYSFL GSIFDPSTSG HLQKLKEMNP IDVETSGLEA  240
LV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0948530.0FP094853.1 Phyllostachys edulis cDNA clone: bphyem208j03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452755.11e-150hypothetical protein SORBIDRAFT_04g031820
SwissprotQ8H0W32e-81RVE6_ARATH; Protein REVEILLE 6
TrEMBLC5Y0Y61e-150C5Y0Y6_SORBI; Putative uncharacterized protein Sb04g031820
STRINGSb04g031820.11e-150(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP109638111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.16e-69MYB_related family protein